SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369519 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369519
Domain Number 1 Region: 11-272
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 5.1e-130
Family Purine and uridine phosphorylases 0.0000000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369519   Gene: ENSG00000099810   Transcript: ENST00000380172
Sequence length 283
Comment pep:known chromosome:GRCh38:9:21802543:21867078:1 gene:ENSG00000099810 transcript:ENST00000380172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Download sequence
Identical sequences A0A0D9RBE9 A0A2I2ZHX6 A0A2I3GRK1 A0A2K5NHT0 A0A2K5YQ29 A0A2K6M620 A0A2K6NAK9 F6RQL9 H9FUP6 K7BQY9 Q13126
ENSPTRP00000035612 9544.ENSMMUP00000001509 9598.ENSPTRP00000035612 9606.ENSP00000369519 ENSPANP00000019181 ENSMMUP00000001508 ENSP00000369519 1cb0A ENSMMUP00000001509 1cb0_A 1cg6_A 1k27_A 1sd1_A 1sd2_A 3ozc_A 3ozd_A 3ozd_B 3oze_A 3oze_B 3oze_C 3oze_D 3oze_E 3oze_F gi|47132622|ref|NP_002442.2| NP_001248666.1.72884 NP_002442.2.87134 NP_002442.2.92137 XP_001153022.1.37143 XP_003260410.1.23891 XP_003830728.1.60992 XP_004047924.1.27298 XP_007967290.1.81039 XP_010351692.1.97406 XP_011827715.1.47321 XP_011927326.1.92194 XP_017739689.1.44346 cath|current|1cb0A00/9-281 cath|current|1cg6A00/9-281 cath|current|1k27A00/9-281 cath|current|1sd1A00/9-281 cath|current|1sd2A00/9-281 cath|current|3ozcA00/9-281 cath|current|3ozdA00/9-281 cath|current|3ozdB00/9-281 cath|current|3ozeA00/9-281 cath|current|3ozeB00/9-281 cath|current|3ozeC00/9-279 cath|current|3ozeD00/9-281 cath|current|3ozeE00/9-281 cath|current|3ozeF00/9-280 ENSP00000369519 ENSNLEP00000021243 ENSPTRP00000035612 ENSGGOP00000012614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]