SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000369671 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369671
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Globin-like 1.75e-30
Family Globins 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369671   Gene: ENSG00000244734   Transcript: ENST00000380315
Sequence length 90
Comment pep:known chromosome:GRCh38:11:5226620:5229395:-1 gene:ENSG00000244734 transcript:ENST00000380315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFATLS
Download sequence
Identical sequences F8W6P5
ENSP00000369671 ENSP00000369671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]