SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000370376 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370376
Domain Number 1 Region: 112-251
Classification Level Classification E-value
Superfamily dUTPase-like 2.22e-49
Family dUTPase-like 0.000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370376   Gene: ENSG00000128951   Transcript: ENST00000331200
Sequence length 252
Comment pep:known chromosome:GRCh38:15:48331423:48343373:1 gene:ENSG00000128951 transcript:ENST00000331200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
Download sequence
Identical sequences P33316
gi|70906441|ref|NP_001020419.1| NP_001020419.1.87134 NP_001020419.1.92137 ENSP00000370376 9606.ENSP00000370376 ENSP00000370376 HR6841 ENSP00000370376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]