SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000370512 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370512
Domain Number 1 Region: 158-239
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.44e-17
Family Translation initiation factor IF3, C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 78-148
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000405
Family Translation initiation factor IF3, N-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370512   Gene: ENSG00000122033   Transcript: ENST00000381120
Sequence length 278
Comment pep:known chromosome:GRCh38:13:27435643:27450574:-1 gene:ENSG00000122033 transcript:ENST00000381120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAED
TQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRN
TSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQ
QWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVL
RAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Download sequence
Identical sequences Q9H2K0
ENSP00000370508 ENSP00000370512 ENSP00000384659 ENSP00000400084 NP_001159733.1.87134 NP_001159733.1.92137 NP_001159734.1.87134 NP_001159734.1.92137 NP_001159735.1.87134 NP_001159735.1.92137 NP_690876.3.87134 NP_690876.3.92137 XP_006719834.1.92137 XP_006719835.1.92137 XP_011533259.1.92137 XP_011533260.1.92137 XP_011533261.1.92137 XP_011533262.1.92137 XP_011533263.1.92137 XP_011533264.1.92137 XP_011533265.1.92137 XP_016875906.1.92137 ENSP00000370508 ENSP00000370508 ENSP00000370512 ENSP00000384659 gi|261878550|ref|NP_690876.3| gi|261878554|ref|NP_001159733.1| gi|261878559|ref|NP_001159734.1| gi|261878564|ref|NP_001159735.1| 9606.ENSP00000370508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]