SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000370719 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000370719
Domain Number 1 Region: 1218-1440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-64
Family DBL homology domain (DH-domain) 0.00000000228
Further Details:      
 
Domain Number 2 Region: 1440-1580
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-32
Family Pleckstrin-homology domain (PH domain) 0.000000201
Further Details:      
 
Domain Number 3 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 5.26e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1594-1714
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-26
Family PLC-like (P variant) 0.011
Further Details:      
 
Domain Number 5 Region: 1147-1219
Classification Level Classification E-value
Superfamily SH3-domain 8.79e-26
Family SH3-domain 0.0000619
Further Details:      
 
Domain Number 6 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 1.27e-25
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 986-1059
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-19
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 8 Region: 913-975
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 9 Region: 740-817
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-18
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 10 Region: 1074-1144
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-18
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000370719   Gene: ENSG00000205726   Transcript: ENST00000381318
Sequence length 1721
Comment pep:known chromosome:GRCh38:21:33642458:33899861:1 gene:ENSG00000205726 transcript:ENST00000381318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQW
LEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAV
QAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTG
EPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATG
SSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGW
FPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGD
LTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQ
VIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGT
SKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQ
VGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT
EIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILS
AQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQ
RVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHV
QCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSG
TDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERT
AWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPY
CEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEI
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences Q15811
9606.ENSP00000370719 ENSP00000370684 ENSP00000370719 gi|47717123|ref|NP_003015.2| ENSP00000370719 HR3646 NP_003015.2.87134 NP_003015.2.92137 XP_016883917.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]