SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000371134 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371134
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-39
Family FKBP immunophilin/proline isomerase 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371134   Gene: ENSG00000088832   Transcript: ENST00000381715
Sequence length 103
Comment pep:putative chromosome:GRCh38:20:1371778:1392962:-1 gene:ENSG00000088832 transcript:ENST00000381715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSVSSGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVA
QMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Download sequence
Identical sequences A0A2J8MS17 A0A2J8VI85 Q5W0X3
ENSP00000371134 ENSP00000371143 ENSP00000371134 ENSP00000371143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]