SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000372224 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000372224
Domain Number 1 Region: 383-646
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-75
Family Eukaryotic proteases 0.0000951
Further Details:      
 
Domain Number 2 Region: 265-378
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-33
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 3 Region: 101-150
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-17
Family Fibronectin type II module 0.0019
Further Details:      
 
Domain Number 4 Region: 161-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000194
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSP00000372224
Domain Number - Region: 199-238
Classification Level Classification E-value
Superfamily FnI-like domain 0.00837
Family Fibronectin type I module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000372224   Gene: ENSG00000109758   Transcript: ENST00000382774
Sequence length 655
Comment pep:known chromosome:GRCh38:4:3441887:3449495:1 gene:ENSG00000109758 transcript:ENST00000382774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
Download sequence
Identical sequences Q04756
9606.ENSP00000372224 ENSP00000372224 NP_001519.1.87134 NP_001519.1.92137 gi|4504383|ref|NP_001519.1| ENSP00000372224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]