SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000375801 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000375801
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 9.61e-16
Family LEM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000375801   Gene: ENSG00000186007   Transcript: ENST00000391936
Sequence length 108
Comment pep:known chromosome:GRCh38:1:205381381:205420582:-1 gene:ENSG00000186007 transcript:ENST00000391936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDG
AQDSDDSEGGLQEHQAPESHMGLSPKRETTARKTRLSRAGEKKVSQWA
Download sequence
Identical sequences ENSP00000356122 ENSP00000375801 NP_001001552.3.87134 NP_001001552.3.92137 gi|56676324|ref|NP_001001552.3| 9606.ENSP00000356122 ENSP00000356122 ENSP00000375801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]