SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376396 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000376396
Domain Number - Region: 88-124,201-234
Classification Level Classification E-value
Superfamily RNI-like 0.00235
Family Cyclin A/CDK2-associated p19, Skp2 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376396   Gene: ENSG00000182352   Transcript: ENST00000392620
Sequence length 243
Comment pep:known chromosome:GRCh38:17:74584918:74594209:1 gene:ENSG00000182352 transcript:ENST00000392620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELALSFSLTCLLPENRASLSPSQPLSFQCLKAPATLTWEDEKQQRWGQPHGPVSSPLL
GDHRCLVPFRDLNPSSEVNTANLLESPSSLLLTSCYICSYFSFYILGEKRCHSLKRLRYS
VCCKVCPNFCACGKENVSGTGQVCTGVHVGAKEQEEPGGTQALRSCGIYCLEERTDKASH
EECRERSTLGRPQCTGLTPSLAGESPCPRLLPGSPTVRHLIASSCPGLSDPLPLPPGTLP
LGS
Download sequence
Identical sequences Q96MU5
NP_001289738.1.87134 NP_001289738.1.92137 NP_689673.2.87134 NP_689673.2.92137 gi|48255962|ref|NP_689673.2| ENSP00000329353 ENSP00000376396 ENSP00000329353 9606.ENSP00000329353 ENSP00000329353 ENSP00000376396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]