SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000376440 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376440
Domain Number 1 Region: 12-138
Classification Level Classification E-value
Superfamily DNA clamp 1.88e-16
Family DNA polymerase processivity factor 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376440   Gene: ENSG00000151164   Transcript: ENST00000392672
Sequence length 429
Comment pep:known chromosome:GRCh38:12:110502239:110532086:1 gene:ENSG00000151164 transcript:ENST00000392672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPV
FFQHYQWSALVKMSENELDTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCK
VVIQFFYRHGIKRTHNICFQESQPLQVIFDKNVCTNTLMIQPRLLADAIVLFTSSQEEVT
LAVTPLNFCLKSSNEESMDLSNAVHSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFS
EATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDL
IEKKAGKNVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESS
VSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNVCCRKEFNG
SDAKYFCII
Download sequence
Identical sequences J3KPN7
ENSP00000376440 ENSP00000386434 ENSP00000376440 gi|169234617|ref|NP_689655.3| 9606.ENSP00000376440 NP_689655.3.87134 NP_689655.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]