SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000376773 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376773
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 3.79e-23
Family LEM domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 107-155
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000288
Family LEM domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376773   Gene: ENSG00000120802   Transcript: ENST00000393053
Sequence length 345
Comment pep:known chromosome:GRCh38:12:98515631:98548957:1 gene:ENSG00000120802 transcript:ENST00000393053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSK
GPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
DRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQVGEKTEERRVERDILKEMF
PYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGR
SIPVWIKILLFVVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN
Download sequence
Identical sequences A0A024RBH7
ENSP00000376773 ENSP00000376773 NP_001027455.1.87134 NP_001027455.1.92137 gi|73760401|ref|NP_001027455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]