SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376862 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376862
Domain Number 1 Region: 53-346
Classification Level Classification E-value
Superfamily L domain-like 3.74e-63
Family Ngr ectodomain-like 0.00000000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376862   Gene: ENSG00000011465   Transcript: ENST00000393155
Sequence length 359
Comment pep:known chromosome:GRCh38:12:91145259:91179582:-1 gene:ENSG00000011465 transcript:ENST00000393155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Download sequence
Identical sequences G2HIN7 P07585 Q5R1V9 Q6FH10
9598.ENSPTRP00000008989 9606.ENSP00000052754 ENSPTRP00000008989 NP_001009082.1.37143 NP_001911.1.87134 NP_001911.1.92137 NP_598010.1.87134 NP_598010.1.92137 XP_003823449.1.60992 XP_005268750.1.92137 XP_006719333.1.92137 XP_008975306.1.60992 XP_009424245.1.37143 XP_016778090.1.37143 XP_016874406.1.92137 gi|19743846|ref|NP_598010.1| gi|4503271|ref|NP_001911.1| ENSP00000052754 ENSP00000376862 ENSP00000447654 ENSP00000052754 ENSP00000376862 ENSP00000447654 ENSPTRP00000008989 ENSP00000376862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]