SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000376959 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376959
Domain Number 1 Region: 121-258
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.8e-35
Family Mismatch glycosylase 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376959   Gene: ENSG00000129071   Transcript: ENST00000393278
Sequence length 262
Comment pep:known chromosome:GRCh38:3:129430952:129440179:-1 gene:ENSG00000129071 transcript:ENST00000393278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSE
CNPLLQEPIASAQFGATAGTECQDTIPRTQIERRKTSLYFSSKYNKEALSPPRRKAFKKW
TPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRD
VSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHP
EDHKLNKYHDWLWENHEKLSLS
Download sequence
Identical sequences ENSP00000376959 NP_001263202.1.87134 NP_001263202.1.92137 ENSP00000376959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]