SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000377001 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377001
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-47
Family MATH domain 0.0000000753
Further Details:      
 
Domain Number 2 Region: 180-295
Classification Level Classification E-value
Superfamily POZ domain 3.45e-34
Family BTB/POZ domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377001   Gene: ENSG00000121067   Transcript: ENST00000393328
Sequence length 374
Comment pep:known chromosome:GRCh38:17:49598884:49678110:-1 gene:ENSG00000121067 transcript:ENST00000393328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
Download sequence
Identical sequences A0A091DJZ2 A0A096P456 A0A1S2ZWH4 A0A1S3GZ44 A0A1U7TQ75 A0A250YGT5 A0A2J8W8V5 A0A2K5D3N0 A0A2K5JVJ8 A0A2K5L8N1 A0A2K5QL04 A0A2K6AEJ9 A0A2K6F129 A0A2K6LJB7 A0A2K6RLM2 A0A2K6UHK5 B2RYD9 D2HMY7 E2RS90 F6X846 F6XVE8 F7A1J9 G1QS99 G1TC83 G3HJP9 G5C4P5 G7PU91 H0X7R0 H2QDD5 I3LA15 M3VYV6 M3YVB9 O43791 Q0VCW1 Q5NVK7 Q6ZWS8
ENSNLEP00000003817 ENSMMUP00000024681 NP_001007227.1.87134 NP_001007227.1.92137 NP_001007228.1.87134 NP_001007228.1.92137 NP_001007229.1.87134 NP_001007229.1.92137 NP_001007230.1.87134 NP_001007230.1.92137 NP_001007231.1.87134 NP_001007231.1.92137 NP_001069404.1.59421 NP_001069404.1.76553 NP_001093966.1.100692 NP_001093966.1.4139 NP_001245102.1.72884 NP_003554.1.87134 NP_003554.1.92137 NP_079563.2.92730 XP_001168235.1.37143 XP_001168317.1.37143 XP_001502489.1.31192 XP_002719349.1.1745 XP_002923781.1.58354 XP_003278810.1.23891 XP_003278811.1.23891 XP_003278812.1.23891 XP_003278813.1.23891 XP_003278814.1.23891 XP_003278815.1.23891 XP_003278816.1.23891 XP_003414700.1.64505 XP_003503997.1.69978 XP_003786531.1.62490 XP_003818090.1.60992 XP_003931303.1.74449 XP_003996760.1.62641 XP_004012837.1.66739 XP_004282690.1.21590 XP_004315259.1.83887 XP_004378015.1.4749 XP_004395190.1.74151 XP_004395191.1.74151 XP_004434714.1.5094 XP_004434715.1.5094 XP_004591135.1.84141 XP_004608740.1.94378 XP_004633700.1.9945 XP_004655606.1.11716 XP_004655607.1.11716 XP_004684375.1.23501 XP_004707129.1.18182 XP_004764847.1.14098 XP_004764848.1.14098 XP_005220628.1.76553 XP_005220629.1.76553 XP_005257780.1.92137 XP_005257781.1.92137 XP_005394265.1.28644 XP_005583676.1.63531 XP_005583677.1.63531 XP_005583678.1.63531 XP_005583679.1.63531 XP_005624685.1.84170 XP_005668928.2.46622 XP_005890403.1.15283 XP_005890404.1.15283 XP_005964724.1.78601 XP_006062030.1.26621 XP_006062031.1.26621 XP_006166236.1.99106 XP_006175014.1.101512 XP_006175015.1.101512 XP_006218699.1.17985 XP_006218700.1.17985 XP_006247242.1.100692 XP_006247244.1.100692 XP_006532755.1.92730 XP_006746740.1.47382 XP_006746741.1.47382 XP_006832546.1.41390 XP_006889377.1.29581 XP_006924842.1.64745 XP_007085768.1.5354 XP_007128593.1.24612 XP_007128594.1.24612 XP_007128595.1.24612 XP_007128596.1.24612 XP_007176477.1.59432 XP_007465145.1.90284 XP_007525689.1.11023 XP_007525690.1.11023 XP_007642666.1.69978 XP_007940127.1.48129 XP_007940128.1.48129 XP_008011256.1.81039 XP_008011257.1.81039 XP_008011258.1.81039 XP_008011259.1.81039 XP_008062147.1.4292 XP_008062148.1.4292 XP_008062149.1.4292 XP_008518582.1.77740 XP_008518583.1.77740 XP_008518584.1.77740 XP_008518585.1.77740 XP_008570017.1.73410 XP_008570018.1.73410 XP_008686357.1.72690 XP_008766190.1.100692 XP_008836538.1.79516 XP_008836539.1.79516 XP_008836540.1.79516 XP_008836541.1.79516 XP_008995643.1.60252 XP_010358307.1.97406 XP_010358316.1.97406 XP_010358323.1.97406 XP_010358326.1.97406 XP_010358332.1.97406 XP_010592649.1.64505 XP_010618431.1.5607 XP_010626808.1.5607 XP_010841068.1.44457 XP_010841069.1.44457 XP_010947561.1.22495 XP_010947569.1.22495 XP_010996898.1.51371 XP_011228763.1.58354 XP_011363393.1.92234 XP_011363394.1.92234 XP_011363395.1.92234 XP_011363397.1.92234 XP_011815310.1.43180 XP_011815312.1.43180 XP_011815313.1.43180 XP_011815314.1.43180 XP_011815315.1.43180 XP_011854680.1.47321 XP_011854681.1.47321 XP_011854683.1.47321 XP_011854684.1.47321 XP_011854685.1.47321 XP_011901603.1.92194 XP_011901604.1.92194 XP_011901605.1.92194 XP_011983043.1.54773 XP_011983044.1.54773 XP_012318907.1.9421 XP_012318908.1.9421 XP_012359109.1.23891 XP_012516852.1.63892 XP_012516860.1.63892 XP_012582035.1.23501 XP_012645165.1.48125 XP_012645166.1.48125 XP_012645168.1.48125 XP_012645169.1.48125 XP_012893534.1.60039 XP_014197634.1.60992 XP_014596522.1.31192 XP_014596524.1.31192 XP_014646294.1.5094 XP_014689249.1.49734 XP_014689250.1.49734 XP_014938854.1.86478 XP_014974723.1.72884 XP_014974724.1.72884 XP_014974725.1.72884 XP_014974726.1.72884 XP_014974727.1.72884 XP_014974728.1.72884 XP_014974729.1.72884 XP_015293717.1.63531 XP_015293718.1.63531 XP_015293719.1.63531 XP_015293720.1.63531 XP_015454797.1.64745 XP_015454798.1.64745 XP_015454799.1.64745 XP_016013937.1.101085 XP_016013939.1.101085 XP_016013940.1.101085 XP_016013941.1.101085 XP_016013942.1.101085 XP_016013943.1.101085 XP_016013944.1.101085 XP_016013945.1.101085 XP_016013946.1.101085 XP_016013947.1.101085 XP_016013948.1.101085 XP_016013950.1.101085 XP_016044829.1.11023 XP_016787963.1.37143 XP_016827421.1.28591 XP_016880693.1.92137 XP_017395580.1.71028 XP_017395581.1.71028 XP_017395582.1.71028 XP_017395583.1.71028 XP_017452619.1.100692 XP_017505926.1.32401 XP_017505927.1.32401 XP_017505928.1.32401 XP_017709490.1.44346 XP_017709491.1.44346 XP_017709492.1.44346 XP_017709493.1.44346 XP_017709495.1.44346 XP_017709496.1.44346 XP_017920396.1.57651 XP_017920397.1.57651 XP_017920398.1.57651 XP_019271371.1.44245 XP_019494345.1.44202 XP_019494346.1.44202 XP_019596184.1.88060 XP_019596185.1.88060 XP_019780476.1.83887 XP_019780477.1.83887 XP_019780478.1.83887 XP_019837407.1.53367 XP_019837408.1.53367 XP_020026956.1.5219 XP_020726885.1.74333 XP_020726886.1.74333 XP_020726887.1.74333 XP_020922796.1.46622 XP_020922797.1.46622 XP_020922798.1.46622 XP_021067256.1.100879 XP_021067257.1.100879 XP_021497313.1.76796 XP_021559561.1.83697 XP_021559563.1.83697 XP_852089.1.84170 XP_865004.1.84170 ENSP00000240327 ENSCJAP00000013277 ENSMPUP00000015279 ENSPANP00000020131 HGL_H00000377005 9544.ENSMMUP00000024681 9598.ENSPTRP00000015931 9600.ENSPPYP00000010012 9606.ENSP00000240327 9796.ENSECAP00000016160 ENSMMUP00000024681 ENSP00000240327 ENSP00000377001 ENSP00000420908 ENSP00000425905 ENSPPYP00000010012 ENSCAFP00000024915 ENSCAFP00000024915 ENSPTRP00000015931 ENSPTRP00000015931 ENSOGAP00000011468 ENSFCAP00000002430 ENSBTAP00000007660 ENSMPUP00000015279 ENSOGAP00000011468 ENSP00000240327 ENSP00000377001 ENSP00000377004 ENSP00000420908 ENSP00000425905 ENSNLEP00000003817 ENSOCUP00000014374 ENSPPYP00000010012 gi|4507183|ref|NP_003554.1| gi|56117828|ref|NP_001007228.1| gi|56117830|ref|NP_001007229.1| gi|56117832|ref|NP_001007230.1| gi|56117834|ref|NP_001007231.1| gi|56117836|ref|NP_001007227.1| ENSBTAP00000007660 ENSMUSP00000103350 ENSMUSP00000103350 ENSMUSP00000103352 ENSECAP00000016160 ENSRNOP00000006230 ENSSARP00000011953 ENSSARP00000011953 ENSECAP00000016160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]