SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377170 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377170
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-37
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377170   Gene: ENSG00000213337   Transcript: ENST00000393537
Sequence length 183
Comment pep:known chromosome:GRCh38:2:96847985:96858095:-1 gene:ENSG00000213337 transcript:ENST00000393537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQP
DSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHG
SNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDL
LSS
Download sequence
Identical sequences H2QID6 Q53RE8
ENSP00000377170 ENSP00000398321 gi|156142184|ref|NP_057550.3| ENSPTRP00000020986 ENSP00000377170 9598.ENSPTRP00000020986 9606.ENSP00000377170 NP_057550.3.87134 NP_057550.3.92137 XP_515633.3.37143 ENSP00000377170 ENSP00000398321 ENSPTRP00000020986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]