SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377850 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377850
Domain Number 1 Region: 82-184
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 1.05e-23
Family Ribosome recycling factor, RRF 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377850   Gene: ENSG00000148187   Transcript: ENST00000394315
Sequence length 201
Comment pep:known chromosome:GRCh38:9:122270864:122323461:1 gene:ENSG00000148187 transcript:ENST00000394315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKA
KAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIA
VVTADGKLALNQISQISMKSPQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRV
PIPQSAKWPMTQWQNWTGIWQ
Download sequence
Identical sequences gi|40317624|ref|NP_954646.1| ENSP00000362828 ENSP00000377850 ENSP00000362828 ENSP00000377850 NP_954646.1.87134 NP_954646.1.92137 XP_011517488.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]