SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377970 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377970
Domain Number 1 Region: 50-129
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000146
Family AHSA1 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377970   Gene: ENSG00000173209   Transcript: ENST00000394457
Sequence length 137
Comment pep:known chromosome:GRCh38:2:61177529:61191203:1 gene:ENSG00000173209 transcript:ENST00000394457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIF
TVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQK
QHFEEIKGSLQLTPLNG
Download sequence
Identical sequences gi|22748839|ref|NP_689605.1| ENSP00000349525 ENSP00000377970 9606.ENSP00000349525 NP_001308229.1.87134 NP_001308229.1.92137 NP_689605.1.87134 NP_689605.1.92137 ENSP00000349525 ENSP00000377970 HR5602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]