SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000377971 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377971
Domain Number 1 Region: 68-185
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-23
Family Ankyrin repeat 0.00057
Further Details:      
 
Domain Number 2 Region: 407-456
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000334
Family LEM domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSP00000377971
Domain Number - Region: 278-337
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 0.0011
Family AglA-like glucosidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377971   Gene: ENSG00000160117   Transcript: ENST00000394458
Sequence length 669
Comment pep:known chromosome:GRCh38:19:17281645:17287646:1 gene:ENSG00000160117 transcript:ENST00000394458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTPVRRGAAWLGTLLGPGEGPPEPRGGAAHAHKPPAGSRKSTDQAVRFGPSQGMCSEAR
LARRLRDALREEEPWAVEELLRCGADPNLVLEDGAAAVHLAAGARHPRGLRCLGALLRQG
GDPNARSVEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGLRPLDLALQQGHLECAR
VLQDLDTRTRTRTRIGAETQEPEPAPGTPGLSGPTDETLDSIALQKQPCRGDNRDIGLEA
DPGPPSLPVPLETVDKHGSSASPPGHWDYSSDASFVTAVEVSGAEDPASDTPPWAGSLPP
TRQGLLHVVHANQRVPRSQGTEAELNARLQALTLTPPNAAGFQSSPSSMPLLDRSPAHSP
PRTPTPGASDCHCLWEHQTSIDSDMATLWLTEDEASSTGGREPVGPCRHLPVSTVSDLEL
LKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIPDVQADE
DALAQQFEQPDPARRWREGVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQTFIRAIFY
VGKGTRARPYVHLWEALGHHGRSRKQPHQACPKVRQILDIWASGCGVVSLHCFQHVVAVE
AYTREACIVEALGIQTLTNQKQGHCYGVVAGWPPARRRRLGVHLLHRALLVFLAEGERQL
HPQDIQARG
Download sequence
Identical sequences ENSP00000377971 NP_689576.5.87134 NP_689576.5.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]