SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000378782 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378782
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.67e-53
Family NadC C-terminal domain-like 0.000024
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.73e-25
Family NadC N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378782   Gene: ENSG00000103485   Transcript: ENST00000395384
Sequence length 297
Comment pep:known chromosome:GRCh38:16:29679037:29698699:1 gene:ENSG00000103485 transcript:ENST00000395384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA
AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG
VEKAVRAARQAADFTLKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF
PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
Download sequence
Identical sequences Q15274
ENSP00000378782 9606.ENSP00000378782 ENSP00000378782 ENSP00000378782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]