SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379089 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000379089
Domain Number - Region: 197-230
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00017
Family DBL homology domain (DH-domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379089   Gene: ENSG00000139132   Transcript: ENST00000395740
Sequence length 235
Comment pep:known chromosome:GRCh38:12:32502170:32638929:1 gene:ENSG00000139132 transcript:ENST00000395740 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEEIKPASASCVSKEKPSKVSDLISRFEGGSSLSNYSDLKKESAVNLNAPRTPGRHGLTT
TPQQKLLSQHLPQRQGNDTDKTQGAQTCVANGVMAAQNQMECEEEKAATLSSDTSIQASE
PLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQE
RENGESPLELEQLDQHHEMKETNEQKLHKIANELLLTERAYVNRLDLLDQKIEWR
Download sequence
Identical sequences E9PNX0
ENSP00000379089 ENSP00000437109 ENSP00000379089 ENSP00000437109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]