SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379373 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379373
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.93e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 8.78e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379373   Gene: ENSG00000140307   Transcript: ENST00000396061
Sequence length 109
Comment pep:known chromosome:GRCh38:15:59639109:59657479:-1 gene:ENSG00000140307 transcript:ENST00000396061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Download sequence
Identical sequences A0A024R5Z5 G3RVY6 H2Q9J2 L5K113 L8I2N0 P52657 Q32L01 W5QI34
Hs4758486___KOG3463 NP_001032708.1.59421 NP_001032708.1.76553 NP_001307858.1.87134 NP_001307858.1.92137 NP_001307859.1.87134 NP_001307859.1.92137 NP_004483.1.87134 NP_004483.1.92137 XP_001173111.1.37143 XP_003827962.1.60992 XP_004010606.1.66739 XP_004056327.1.27298 XP_004056328.1.27298 XP_004056329.1.27298 XP_005685756.1.57651 XP_005685757.1.57651 XP_005903909.1.15283 XP_005955311.1.78601 XP_006072398.1.26621 XP_006072399.1.26621 XP_006920370.1.64745 XP_008951483.1.60992 XP_010835137.1.44457 XP_011361701.1.92234 XP_011361702.1.92234 XP_012025920.1.54773 XP_012025921.1.54773 XP_012036818.1.66739 XP_015451600.1.64745 XP_016064040.1.3490 XP_016064041.1.3490 XP_016783801.1.37143 XP_018866446.1.27298 XP_019824307.1.53367 gi|4758486|ref|NP_004483.1| ENSPTRP00000012186 5iy6_O 5iy7_O 5iy8_O 5iy9_O 5iya_O 5iyb_O 5iyc_O 5iyd_O ENSP00000379372 ENSBTAP00000013602 ENSP00000379372 ENSP00000379373 ENSP00000379375 ENSBTAP00000013602 ENSOARP00000022385 ENSGGOP00000019967 ENSGGOP00000019967 ENSP00000379372 ENSP00000379373 ENSP00000379375 9598.ENSPTRP00000012186 9606.ENSP00000379372 9913.ENSBTAP00000013602 ENSPTRP00000012186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]