SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379376 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379376
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.17e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379376   Gene: ENSG00000140307   Transcript: ENST00000396064
Sequence length 68
Comment pep:novel chromosome:GRCh38:15:59638866:59657520:-1 gene:ENSG00000140307 transcript:ENST00000396064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRI
LAPILQNE
Download sequence
Identical sequences A0A2I2YA83 A0A2I3RLX3 A8MYR4
ENSP00000379376 ENSP00000379376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]