SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000379650 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379650
Domain Number 1 Region: 86-159
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.23e-22
Family Frataxin-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379650   Gene: ENSG00000165060   Transcript: ENST00000396364
Sequence length 171
Comment pep:known chromosome:GRCh38:9:69035563:69100178:1 gene:ENSG00000165060 transcript:ENST00000396364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSRLTWLLWLFHP
Download sequence
Identical sequences gi|239787198|ref|NP_001155178.1| ENSP00000379650 NP_001155178.1.87134 NP_001155178.1.92137 ENSP00000379650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]