SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000380157 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380157
Domain Number 1 Region: 46-184
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.29e-47
Family Molybdopterin synthase subunit MoaE 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380157   Gene: ENSG00000164172   Transcript: ENST00000396954
Sequence length 188
Comment pep:known chromosome:GRCh38:5:53098062:53109759:-1 gene:ENSG00000164172 transcript:ENST00000396954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNK
ECFWASNS
Download sequence
Identical sequences A0A024QZS1 O96007
ENSP00000380157 9606.ENSP00000339580 ENSP00000380157 gi|4758732|ref|NP_004522.1| NP_004522.1.87134 NP_004522.1.92137 ENSP00000380157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]