SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380239 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380239
Domain Number 1 Region: 8-139
Classification Level Classification E-value
Superfamily Nudix 7.1e-53
Family MutT-like 0.000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380239   Gene: ENSG00000106268   Transcript: ENST00000397046
Sequence length 156
Comment pep:known chromosome:GRCh38:7:2242259:2251145:1 gene:ENSG00000106268 transcript:ENST00000397046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Download sequence
Identical sequences A0A024R819 H2PLB8
000006237|e1iryA1|221.4.1.3|A:1-156 cath|current|1iryA00/1-156 cath|current|3whwA00/3-156 cath|current|3whwB00/3-156 cath|current|3zr0A00/3-156 cath|current|3zr0B00/2-156 cath|current|3zr1A00/3-156 cath|current|3zr1B00/2-156 d1irya_ ENSPPYP00000019399 1iry_A 3whw_A 3whw_B 3zr0_A 3zr0_B 3zr1_A 3zr1_B 5fsi_A 5fsl_A 5fsm_A 5fsn_A 5fso_A ENSP00000343439 ENSP00000349148 ENSP00000380239 ENSP00000380242 gi|40288274|ref|NP_002443.3| gi|40288276|ref|NP_945186.1| gi|40288280|ref|NP_945188.1| gi|40288284|ref|NP_945191.1| 1iryA 9600.ENSPPYP00000019399 NP_002443.3.87134 NP_002443.3.92137 NP_945186.1.87134 NP_945186.1.92137 NP_945188.1.87134 NP_945188.1.92137 NP_945191.1.87134 NP_945191.1.92137 XP_002817685.1.23681 XP_002817686.1.23681 XP_009240766.1.23681 ENSP00000343439 ENSP00000349148 ENSP00000380239 ENSPPYP00000019399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]