SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381435 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381435
Domain Number 1 Region: 130-234
Classification Level Classification E-value
Superfamily DNA-binding domain 3.92e-31
Family Methyl-CpG-binding domain, MBD 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381435   Gene: ENSG00000134046   Transcript: ENST00000398398
Sequence length 241
Comment pep:novel chromosome:GRCh38:18:54202680:54224647:-1 gene:ENSG00000134046 transcript:ENST00000398398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRG
RGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGG
APRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYF
SPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKFVCTFL
L
Download sequence
Identical sequences A0A2J8NDZ0 A0A2J8UEM6 X6RBL6
ENSP00000381435 ENSP00000381435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]