SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381446 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381446
Domain Number 1 Region: 36-144
Classification Level Classification E-value
Superfamily Cystatin/monellin 3.83e-36
Family Cystatins 0.000000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381446   Gene: ENSG00000101439   Transcript: ENST00000398409
Sequence length 146
Comment pep:known chromosome:GRCh38:20:23633657:23638473:-1 gene:ENSG00000101439 transcript:ENST00000398409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY
NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK
AFCSFQIYAVPWQGTMTLSKSTCQDA
Download sequence
Identical sequences A0A0K0K1J1 H2P181 K7AAK0 P01034
9600.ENSPPYP00000012040 9606.ENSP00000366124 ENSP00000366124 ENSP00000366124 ENSP00000381446 ENSP00000381448 ENSP00000366124 ENSP00000381446 ENSP00000381448 NP_000090.1.87134 NP_000090.1.92137 NP_001275543.1.87134 NP_001275543.1.92137 XP_016793041.1.37143 ENSPPYP00000012040 ENSPPYP00000012040 gi|4503107|ref|NP_000090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]