SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000381568 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381568
Domain Number 1 Region: 138-356
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-53
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381568   Gene: ENSG00000104728   Transcript: ENST00000398560
Sequence length 380
Comment pep:known chromosome:GRCh38:8:1858755:1904096:1 gene:ENSG00000104728 transcript:ENST00000398560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFESYEEQSDSEC
KNGIPRSFLRSNHKKQMQKLVKAAKDGTKDGLERTRAAVKRGRSFIRTKSLIAQDHRSSL
EEEQNLFIDVDCKHPEAILTPMPEGLSQQQVVRRYILGSVVDSEKNYVDALKRILEQYEK
PLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKS
MVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQEQEASPDRTTLYSLMMKPIQRFPQ
FILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEVKQIAKAINERY
LNKVERGFLQLYSKIIFALC
Download sequence
Identical sequences A0A2J8JDG8 E9PB39
ENSP00000381568 ENSP00000477521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]