SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000382327 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382327
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.75e-36
Family Tyrosine-dependent oxidoreductases 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382327   Gene: ENSG00000100445   Transcript: ENST00000399395
Sequence length 293
Comment pep:known chromosome:GRCh38:14:24439766:24442803:-1 gene:ENSG00000100445 transcript:ENST00000399395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLVGGGTGFIGTALTQLLNARGHEVTLVSRKPGPGRITWDELAASGLPSCDAAVNLAG
ENILNPLRRWNETFQKEVIGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEY
DEDSPGGDFDFFSNLVTKWEAAARLPGDSTRQVVVRSGVVLGRGGGAMGHMLLPFRLGLG
GPIGSGHQFFPWIHIGDLAGILTHALEANHVHGVLNGVAPSSATNAEFAQTLGAALGRRA
FIPLPSAVVQAVFGRQRAIMLLEGQKVIPQRTLATGYQYSFPELGAALKEIVA
Download sequence
Identical sequences ENSP00000382322 ENSP00000382327 9606.ENSP00000382327 HR5994 ENSP00000382327 NP_064580.2.87134 NP_064580.2.92137 gi|116812630|ref|NP_064580.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]