SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000382793 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382793
Domain Number 1 Region: 32-411
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.55e-72
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 431-545,664-804
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.45e-66
Family Phosphate binding protein-like 0.00000000105
Further Details:      
 
Weak hits

Sequence:  ENSP00000382793
Domain Number - Region: 514-659
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000373
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382793   Gene: ENSG00000171189   Transcript: ENST00000399909
Sequence length 903
Comment pep:novel chromosome:GRCh38:21:29553252:29939912:-1 gene:ENSG00000171189 transcript:ENST00000399909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKIGIWNSNSGLNMTDSNKD
KSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYD
VKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRN
SDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFIVLAAGLVLSVFVAIG
EFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECGKLIREERGIRKQSSV
HTV
Download sequence
Identical sequences A0A2J8MQ20 E7EPZ0
XP_005261001.1.92137 ENSP00000382793 ENSP00000382793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]