SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000382797 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382797
Domain Number 1 Region: 32-426
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.28e-70
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 446-560,679-819
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.88e-66
Family Phosphate binding protein-like 0.00000000105
Further Details:      
 
Weak hits

Sequence:  ENSP00000382797
Domain Number - Region: 529-674
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000746
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382797   Gene: ENSG00000171189   Transcript: ENST00000399913
Sequence length 920
Comment pep:novel chromosome:GRCh38:21:29536933:29939674:-1 gene:ENSG00000171189 transcript:ENST00000399913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKS
SFTSILTCHQRRTQRKETVA
Download sequence
Identical sequences A0A2I3SZD4 E9PD61
ENSP00000382797 NP_001307545.1.87134 NP_001307545.1.92137 XP_009424124.1.37143 ENSP00000382797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]