SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000382830 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382830
Domain Number 1 Region: 150-367
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-60
Family DBL homology domain (DH-domain) 0.0000000651
Further Details:      
 
Domain Number 2 Region: 353-506
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-47
Family Pleckstrin-homology domain (PH domain) 0.00000212
Further Details:      
 
Domain Number 3 Region: 51-177
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-24
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382830   Gene: ENSG00000182957   Transcript: ENST00000399949
Sequence length 574
Comment pep:putative chromosome:GRCh38:13:24270688:24303904:1 gene:ENSG00000182957 transcript:ENST00000399949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVARGEIARFWSLESLHLVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQL
AINELISDGNVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPA
SFVRLRVNQEELSENSSSTPSEEQDEEASQSRHRHCENKQQMRTNVIREIMDTERVYIKH
LRDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIG
SCFLQNQEGFAIYSEYCNNHPGACLELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLT
PVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQ
VSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCKKDLLRRDMLYY
KGRLDMDEMELVDLGDGRDKDCNLSVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACAD
ERRRVQEDKEMGMEISENQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITM
PTSVPQQQVFGLAEPKRKSSLFWHTFNRLTPFRK
Download sequence
Identical sequences ENSP00000382830 NP_001273724.1.87134 NP_001273724.1.92137 ENSP00000382830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]