SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000383189 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383189
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-28
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383189   Gene: ENSG00000183762   Transcript: ENST00000400335
Sequence length 458
Comment pep:known chromosome:GRCh38:22:29073078:29146820:1 gene:ENSG00000183762 transcript:ENST00000400335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFW
NETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
NLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKY
GEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGR
VCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDF
VILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLY
VITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPG
TSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences ENSP00000383189 gi|227116325|ref|NP_001034659.2| NP_001034659.2.87134 NP_001034659.2.92137 XP_004063279.1.27298 ENSP00000383189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]