SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000384597 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384597
Domain Number 1 Region: 422-478
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.88e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000523
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384597   Gene: ENSG00000242441   Transcript: ENST00000403751
Sequence length 478
Comment pep:known chromosome:GRCh38:2:48617838:48679607:1 gene:ENSG00000242441 transcript:ENST00000403751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVP
AGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTSVPQLNPWSL
QATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEALLCHQESSH
YISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILK
NRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQVDGSGDTSSNEE
IGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences A0A140VKA3 Q9UNN4
ENSP00000384597 9606.ENSP00000384597 gi|26787968|ref|NP_006863.2| ENSP00000394793 NP_006863.2.87134 NP_006863.2.92137 ENSP00000384597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]