SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384865 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384865
Domain Number 1 Region: 73-147
Classification Level Classification E-value
Superfamily DNA-binding domain 9.81e-24
Family Methyl-CpG-binding domain, MBD 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384865   Gene: ENSG00000169057   Transcript: ENST00000407218
Sequence length 172
Comment pep:novel chromosome:GRCh38:X:154031013:154097691:-1 gene:ENSG00000169057 transcript:ENST00000407218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAG
KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKLQELAEAGDAPKGAAPRDPRRPRQRVCR
Download sequence
Identical sequences A0A0D9SFX7 A0A2J8INB2 A0A2J8RLS7
ENSP00000384865 ENSP00000384865 ENSP00000471217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]