SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385204 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385204
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-22
Family Kringle modules 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385204   Gene: ENSG00000100100   Transcript: ENST00000402249
Sequence length 234
Comment pep:known chromosome:GRCh38:22:31289038:31292479:-1 gene:ENSG00000100100 transcript:ENST00000402249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRSVASLLGPLRRRGGRYTKSNFVAFLPKRKQDVENQLKM
Download sequence
Identical sequences ENSP00000385204 ENSP00000385204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]