SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385206 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385206
Domain Number 1 Region: 15-87
Classification Level Classification E-value
Superfamily Homeodomain-like 2.27e-19
Family Homeodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385206   Gene: ENSG00000177426   Transcript: ENST00000401449
Sequence length 252
Comment pep:known chromosome:GRCh38:18:3411927:3458406:1 gene:ENSG00000177426 transcript:ENST00000401449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTL
QVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETP
FHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDI
QQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKR
AAEMELQAKLTA
Download sequence
Identical sequences ENSP00000343969 ENSP00000383031 ENSP00000384970 ENSP00000385206 ENSP00000447747 ENSP00000449501 ENSP00000450025 NP_001265615.1.87134 NP_001265615.1.92137 NP_775301.1.87134 NP_775301.1.92137 NP_775302.1.87134 NP_775302.1.92137 NP_775303.1.87134 NP_775303.1.92137 NP_777480.1.87134 NP_777480.1.92137 XP_011524037.1.92137 XP_016881448.1.92137 gi|28178851|ref|NP_775301.1| gi|28178853|ref|NP_775302.1| gi|28178855|ref|NP_775303.1| gi|28178857|ref|NP_777480.1| ENSP00000343969 ENSP00000383031 ENSP00000384970 ENSP00000385206 ENSP00000449501 ENSP00000450025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]