SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385362 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385362
Domain Number 1 Region: 189-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-53
Family DBL homology domain (DH-domain) 0.00000173
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.28e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 4e-33
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 4 Region: 658-759,807-833
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-26
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 5 Region: 566-652
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000814
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 6 Region: 762-835
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000019
Family SH3-domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385362   Gene: ENSG00000160293   Transcript: ENST00000406606
Sequence length 839
Comment pep:known chromosome:GRCh38:9:133761894:133992281:-1 gene:ENSG00000160293 transcript:ENST00000406606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEA
MQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLT
FQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIH
ITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIG
TAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSP00000385362 ENSP00000385362 NP_003362.2.87134 NP_003362.2.92137 gi|40549448|ref|NP_003362.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]