SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385431 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385431
Domain Number 1 Region: 30-126
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-28
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 214-321
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385431   Gene: ENSG00000183762   Transcript: ENST00000407188
Sequence length 473
Comment pep:known chromosome:GRCh38:22:29073131:29142112:1 gene:ENSG00000183762 transcript:ENST00000407188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPSPGLGPECFTANGADYRGTQNWTALQGGKPCLFWNE
TFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNL
GCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGE
AASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVC
YWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVI
LYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVI
TTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWTVYGLATLLILTVTAIVAKILLHVTFKSH
RVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences G3QID4 Q96MU8
ENSP00000385431 ENSP00000385431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]