SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385581 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385581
Domain Number 1 Region: 296-396
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.49e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 29-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.16e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 113-167,195-214
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385581   Gene: ENSG00000133794   Transcript: ENST00000403510
Sequence length 582
Comment pep:known chromosome:GRCh38:11:13277842:13387263:1 gene:ENSG00000133794 transcript:ENST00000403510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCN
AMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVG
CDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAK
TGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCTIHS
TGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRH
AIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCY
KFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMD
SMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNI
TSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMI
DNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences A0A2J8P5C6 A0A2J8UQ25 A0A2K5ZV98
ENSMMUP00000012674 gi|71852582|ref|NP_001025444.1| NP_001025444.1.87134 NP_001025444.1.92137 XP_004050774.1.27298 XP_005578632.1.63531 XP_009244846.1.23681 XP_009458249.1.37143 XP_010386701.1.97406 XP_011518415.1.92137 XP_011748338.1.29376 XP_011748339.1.29376 XP_011856853.1.47321 XP_011937259.1.92194 XP_014202227.1.60992 XP_014970223.1.72884 XP_014970224.1.72884 XP_015983667.1.101085 XP_016873237.1.92137 ENSP00000385581 ENSP00000385581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]