SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000385915 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385915
Domain Number 1 Region: 297-397
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.49e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 29-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.16e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 113-167,195-214
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385915   Gene: ENSG00000133794   Transcript: ENST00000401424
Sequence length 583
Comment pep:known chromosome:GRCh38:11:13277798:13387266:1 gene:ENSG00000133794 transcript:ENST00000401424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCN
AMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVG
CDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAK
TGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIH
STGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSR
HAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNC
YKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSM
DSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLN
ITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDM
IDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences A0A096NU97 A0A2I2ZU95 A0A2K5KXF3 A0A2K5X129 A0A2K6E4P6 A0A2K6Q7B8 H2NE24 K7B3B1
ENSPPYP00000003988 ENSPPYP00000003988 ENSP00000385915 NP_001284653.1.87134 NP_001284653.1.92137 XP_005578631.1.63531 XP_009458248.1.37143 XP_011518414.1.92137 XP_011748337.1.29376 XP_011856848.1.47321 XP_011937257.1.92194 XP_014202226.1.60992 XP_014970222.1.72884 XP_015983666.1.101085 XP_016873235.1.92137 XP_016873236.1.92137 XP_018893032.1.27298 XP_018893033.1.27298 9598.ENSPTRP00000043973 ENSP00000385915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]