SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386194 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386194
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.48e-46
Family D-ribulose-5-phosphate 3-epimerase 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386194   Gene: ENSG00000197713   Transcript: ENST00000408981
Sequence length 159
Comment pep:novel chromosome:GRCh38:2:210002624:210019785:1 gene:ENSG00000197713 transcript:ENST00000408981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYL
APWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAE
AGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLD
Download sequence
Identical sequences A0A2J8N604 A0A2J8XSX6 C9J6A7
ENSP00000386194 ENSP00000386194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]