SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386283 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000386283
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily LysM domain 0.00746
Family LysM domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386283   Gene: ENSG00000183060   Transcript: ENST00000409796
Sequence length 296
Comment pep:known chromosome:GRCh38:15:99727405:99733339:-1 gene:ENSG00000183060 transcript:ENST00000409796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHEELLTKTFQGPAVVCGTPTSHVYMFKNGSGDSGDSSEEESHRVVLRPRGKERHKSGV
HQPPQAGAGDVVLLQRELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSVKIPV
RNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERA
VQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYF
KIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS
Download sequence
Identical sequences Q5XG99
ENSP00000386283 ENSP00000333008 ENSP00000386283 NP_001271346.1.87134 NP_001271346.1.92137 NP_001271347.1.87134 NP_001271347.1.92137 XP_016877415.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]