SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386556 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386556
Domain Number 1 Region: 5-61
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000293
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386556   Gene: ENSG00000115468   Transcript: ENST00000409613
Sequence length 143
Comment pep:putative chromosome:GRCh38:2:232606057:232682340:1 gene:ENSG00000115468 transcript:ENST00000409613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFH
KAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDER
KREEEERRLRQAAFQKLKANFNT
Download sequence
Identical sequences A0A2I3SDW6
ENSP00000386556 NP_001230181.1.87134 NP_001230181.1.92137 ENSP00000386556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]