SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000386697 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386697
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000000977
Family DNA polymerase processivity factor 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386697   Gene: ENSG00000151164   Transcript: ENST00000409778
Sequence length 341
Comment pep:novel chromosome:GRCh38:12:110502314:110532004:1 gene:ENSG00000151164 transcript:ENST00000409778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMLKCVMSGSQVKVFGKAVQALSRISDEFWLDPSKKGLALRCVNSSRSAYGCVLFSPV
FFQHYQWSALVKMSENELDTTLHLKCKLGMKSILPIFRCLNSLERNIEKCRIFTRSDKCK
VVIQFFYRHDLSNAVHSEMFVGSDEFDFFQIGMDTEITFCFKELKGILTFSEATHAPISI
YFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCLSQKRKRSDLIEKKAGKNV
TGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESSVSNTEEVPG
SLCLRKCAAGKNLMEVMPNISVLSDIEQYPPLPRQPEFGVE
Download sequence
Identical sequences B4DYM6
ENSP00000386697 ENSP00000386697 NP_001273465.1.87134 NP_001273465.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]