SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387285 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387285
Domain Number 1 Region: 414-570
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-47
Family Pleckstrin-homology domain (PH domain) 0.00000222
Further Details:      
 
Domain Number 2 Region: 275-426
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-40
Family DBL homology domain (DH-domain) 0.00000315
Further Details:      
 
Domain Number 3 Region: 182-300
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-23
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387285   Gene: ENSG00000136002   Transcript: ENST00000409303
Sequence length 630
Comment pep:novel chromosome:GRCh38:2:130930958:131046189:1 gene:ENSG00000136002 transcript:ENST00000409303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPH
RSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVKCWRKTIITSPESLNLPRRSH
PLSQSAPTGLNHMGWPEHTPGTAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGG
GGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGE
GWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYI
KHLRDICEQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFL
LTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQ
WQSSIEDWEGEDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDV
LYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKA
FAREREQVQLDQETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSNR
PQQQVLVLAEPRRKPSTFWHSISRLAPFRK
Download sequence
Identical sequences A0A087X0P1
ENSP00000387285 ENSP00000483548 ENSP00000387285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]