SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387413 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387413
Domain Number 1 Region: 93-187
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-33
Family Kringle modules 0.00000771
Further Details:      
 
Domain Number 2 Region: 199-287
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 3 Region: 33-94
Classification Level Classification E-value
Superfamily GLA-domain 3.03e-20
Family GLA-domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387413   Gene: ENSG00000180210   Transcript: ENST00000442468
Sequence length 324
Comment pep:putative chromosome:GRCh38:11:46719309:46726626:1 gene:ENSG00000180210 transcript:ENST00000442468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWGLLAGQSTQSWPLMFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSYEEA
FEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQ
LWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQ
VTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQD
FNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRA
IEGRTATSEYQTFFNPRTFGSGEA
Download sequence
Identical sequences C9JV37
ENSP00000387413 ENSP00000387413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]