SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387565 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387565
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-21
Family GDI-like N domain 0.000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387565   Gene: ENSG00000057608   Transcript: ENST00000447751
Sequence length 203
Comment pep:putative chromosome:GRCh38:10:5765849:5785922:-1 gene:ENSG00000057608 transcript:ENST00000447751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLG
ELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVE
KVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDLLASVTSWYQKTWEQKARSLF
PAHMMPPLILRQRVMTLKTSIRG
Download sequence
Identical sequences Q5SX91
ENSP00000387565 ENSP00000387565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]