SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000387956 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387956
Domain Number 1 Region: 49-117
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.00000000164
Family Iron-containing alcohol dehydrogenase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387956   Gene: ENSG00000147576   Transcript: ENST00000422166
Sequence length 131
Comment pep:known chromosome:GRCh38:8:66432505:66454067:1 gene:ENSG00000147576 transcript:ENST00000422166 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAV
TKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSRHH
FESHQTHTGTD
Download sequence
Identical sequences B4DFI7
ENSP00000387956 ENSP00000387956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]