SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388073 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388073
Domain Number 1 Region: 126-189
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000245
Family Protein kinases, catalytic subunit 0.0000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388073   Gene: ENSG00000087586   Transcript: ENST00000420474
Sequence length 189
Comment pep:known chromosome:GRCh38:20:56382985:56392267:-1 gene:ENSG00000087586 transcript:ENST00000420474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQ
AQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLR
Download sequence
Identical sequences ENSP00000388073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]